PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_011099959.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Pedaliaceae; Sesamum
Family Dof
Protein Properties Length: 338aa    MW: 36430.7 Da    PI: 8.9244
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_011099959.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof125.12.3e-393593361
          zf-Dof  3 ekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61
                    e alkcprCds ntkfCyynnysl+qPr+fCk+CrryWtkGGalrnvP+Ggg+rk+kk 
  XP_011099959.1 35 EPALKCPRCDSPNTKFCYYNNYSLTQPRHFCKTCRRYWTKGGALRNVPIGGGCRKSKKI 93
                    6789****************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF027013.2E-333792IPR003851Zinc finger, Dof-type
ProDomPD0074781.0E-273792IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.3483892IPR003851Zinc finger, Dof-type
PROSITE patternPS0136104076IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010052Biological Processguard cell differentiation
GO:0010118Biological Processstomatal movement
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:1902066Biological Processregulation of cell wall pectin metabolic process
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 338 aa     Download sequence    Send to blast
MMSPQDNNII AAKPAGKGES QSSTGRKTSS ARPQEPALKC PRCDSPNTKF CYYNNYSLTQ  60
PRHFCKTCRR YWTKGGALRN VPIGGGCRKS KKIKPSPAAG NSSNDHSADV GGLKFFQGLS  120
PAMDFQLGGL QSPSSGVLNQ FALAFGPGLS RTSGGISSSP NSGISSPLMG FSSSFPLSSA  180
LKQGDHSTQL SGFHQELGAM NFHSSSNNLA ISSIECLSSI NQELHWKLQQ QRLAMLFVNG  240
DNHHKLSSTM IPAATIEPLI IQRQQPITFQ NLENSIPESC LIGTSSRKDG TEWFFDNSYA  300
NVAPTPATSS SNNVNENASN WSGIQGWSEL TQFDEKIV
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011099959.10.0PREDICTED: dof zinc finger protein DOF5.7-like
TrEMBLA0A061DI281e-112A0A061DI28_THECC; Dof-type zinc finger DNA-binding family protein
STRINGVIT_00s0218g00040.t011e-104(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA52422234
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G65590.13e-58Dof family protein